NSJ Bioreagents

ACTN3 Antibody / Alpha Actinin 3

Product Code:
 
NSJ-RQ4625
Product Group:
 
Primary Antibodies
Supplier:
 
NSJ Bioreagents
Host Type:
 
Mouse
Antibody Isotype:
 
Mouse IgG1
Antibody Clonality:
 
Monoclonal
Antibody Clone:
 
9B5
Regulatory Status:
 
RUO
Target Species:
  • Mouse
  • Rat
Applications:
  • Immunohistochemistry- Paraffin Embedded (IHC-P)
  • Western Blot (WB)
Storage:
 
After reconstitution, the ACTN3 antibody can be stored for up to one month at 40. For long-term, aliquot and store at -200. Avoid repeated freezing and thawing.
1 / 2
Western blot tesing of 1) rat skeletal muscle and 2) mouse skeletal muscle lysate with ACTN3 antibody at 0.5ug/ml. Predicted molecular weight ~103 kDa.
2 / 2
IHC staining of FFPE human skeletal muscle with ACTN3 antibody at 1ug/ml. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min followed by cooling at RT for 20 min.

Western blot tesing of 1) rat skeletal muscle and 2) mouse skeletal muscle lysate with ACTN3 antibody at 0.5ug/ml. Predicted molecular weight ~103 kDa.
IHC staining of FFPE human skeletal muscle with ACTN3 antibody at 1ug/ml. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min followed by cooling at RT for 20 min.

No additional charges, what you see is what you pay! *

CodeSizePrice
NSJ-RQ4625-100ug100ug£535.00
Quantity:
Prices exclude any Taxes / VAT
Stay in control of your spending. These prices have no additional charges, not even shipping!
* Rare exceptions are clearly labelled (only 0.14% of items!).
Multibuy discounts available! Contact us to find what you can save.
This product comes from: United States.
Typical lead time: 10-14 working days.
Contact us for more accurate information.
  • Further Information
  • Documents
  • Show All

Further Information

Application Details :
Western blot: 0.5-1ug/ml,Immunohistochemistry (FFPE): 1-2ug/ml
Application Note:
Optimal dilution of the ACTN3 antibody should be determined by the researcher.
Description:
Alpha-actinin-3, also known as alpha-actinin skeletal muscle isoform 3 or F-actin cross-linking protein, is a protein that in humans is encoded by the ACTN3 gene. This gene encodes a member of the alpha-actin binding protein gene family. The encoded protein is primarily expressed in skeletal muscle and functions as a structural component of sarcomeric Z line. This protein is involved in crosslinking actin containing thin filaments. An allelic polymorphism in this gene results in both coding and non-coding variants; the reference genome represents the coding allele. The non-functional allele of this gene is associated with elite athlete status.
Format :
Purified
Formulation :
0.5mg/ml if reconstituted with 0.2ml sterile DI water
Immunogen:
Amino acids EADRERGAIMGIQGEIQKICQTYGLRPCSTNPYITLSPQDINTK were used as the immunogen for the ACTN3 antibody.
Localization:
Cytoplasmic, extracellular
Purity:
Protein G affinity
Species Reactivity :
Mouse, Rat
Uniprot #:
Q08043