NSJ Bioreagents

MOG Antibody / Myelin Oligodendrocyte Glycoprotein

Product Code:
 
NSJ-RQ4651
Product Group:
 
Primary Antibodies
Supplier:
 
NSJ Bioreagents
Host Type:
 
Rabbit
Antibody Isotype:
 
Rabbit IgG
Antibody Clonality:
 
Polyclonal
Regulatory Status:
 
RUO
Target Species:
  • Human
  • Mouse
  • Rat
Applications:
  • Fluorescence-activated cell sorting (FACS)
  • Immunohistochemistry- Paraffin Embedded (IHC-P)
  • Western Blot (WB)
Storage:
 
After reconstitution, the MOG antibody can be stored for up to one month at 40. For long-term, aliquot and store at -200. Avoid repeated freezing and thawing.
1 / 6
Western blot testing of 1) rat brain and 2) mouse brain lysate with MOG antibody at 0.5ug/ml. Expected molecular weight: 15-28 kDa depending on glycosylation level.
2 / 6
IHC staining of FFPE human glioma with MOG antibody at 1ug/ml. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min followed by cooling at RT for 20 min.
3 / 6
IHC staining of FFPE mouse brain with MOG antibody at 1ug/ml. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min followed by cooling at RT for 20 min.
4 / 6
IHC staining of FFPE rat brain with MOG antibody at 1ug/ml. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min followed by cooling at RT for 20 min.
5 / 6
IHC staining of FFPE rat brain with MOG antibody at 1ug/ml. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min followed by cooling at RT for 20 min.
6 / 6
Flow cytometry testing of human U251 cells with MOG antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= MOG antibody.

Western blot testing of 1) rat brain and 2) mouse brain lysate with MOG antibody at 0.5ug/ml. Expected molecular weight: 15-28 kDa depending on glycosylation level.
IHC staining of FFPE human glioma with MOG antibody at 1ug/ml. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min followed by cooling at RT for 20 min.
IHC staining of FFPE mouse brain with MOG antibody at 1ug/ml. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min followed by cooling at RT for 20 min.
IHC staining of FFPE rat brain with MOG antibody at 1ug/ml. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min followed by cooling at RT for 20 min.
IHC staining of FFPE rat brain with MOG antibody at 1ug/ml. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min followed by cooling at RT for 20 min.
Flow cytometry testing of human U251 cells with MOG antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= MOG antibody.

No additional charges, what you see is what you pay! *

CodeSizePrice
NSJ-RQ4651-100ug100ug£535.00
Quantity:
Prices exclude any Taxes / VAT
Stay in control of your spending. These prices have no additional charges, not even shipping!
* Rare exceptions are clearly labelled (only 0.14% of items!).
Multibuy discounts available! Contact us to find what you can save.
This product comes from: United States.
Typical lead time: 10-14 working days.
Contact us for more accurate information.
  • Further Information
  • Documents
  • Show All

Further Information

Application Details :
Western blot: 0.5-1ug/ml,Immunohistochemistry (FFPE): 1-2ug/ml,Flow cytometry: 1-3ug/million cells
Application Note:
Optimal dilution of the MOG antibody should be determined by the researcher.
Description:
Myelin oligodendrocyte glycoprotein (MOG) is a glycoprotein believed to be important in the myelination of nerves in the central nervous system (CNS). In humans this protein is encoded by the MOG gene. This gene is mapped to 6p22.1. It is speculated to serve as a necessary adhesion molecule to provide structural integrity to the myelin sheath and is known to develop late on the oligodendrocyte. The product of this gene is a membrane protein expressed on the oligodendrocyte cell surface and the outermost surface of myelin sheaths. Due to this localization, it is a primary target antigen involved in immune-mediated demyelination. This protein may be involved in completion and maintenance of the myelin sheath and in cell-cell communication. Alternatively spliced transcript variants encoding different isoforms have been identified.
Format :
Purified
Formulation :
0.5mg/ml if reconstituted with 0.2ml sterile DI water
Immunogen:
Amino acids RVVHLYRNGKDQDGDQAPEYRGRTELLKDAIGEGK were used as the immunogen for the MOG antibody.
Limitation:
This MOG antibody is available for research use only.
Localization:
Plasma membrane
Purity:
Antigen affinity purified
Species Reactivity :
Human, Mouse, Rat
Uniprot #:
Q16653