NSJ Bioreagents

PCDH15 Antibody / Protocadherin 15

Product Code:
 
NSJ-RQ4652
Product Group:
 
Primary Antibodies
Supplier:
 
NSJ Bioreagents
Host Type:
 
Rabbit
Antibody Isotype:
 
Rabbit IgG
Antibody Clonality:
 
Polyclonal
Regulatory Status:
 
RUO
Target Species:
  • Human
  • Mouse
  • Rat
Applications:
  • Immunohistochemistry- Paraffin Embedded (IHC-P)
  • Western Blot (WB)
Storage:
 
After reconstitution, the PCDH15 antibody can be stored for up to one month at 40. For long-term, aliquot and store at -200. Avoid repeated freezing and thawing.
1 / 8
Western blot testing of 1) human placenta 2) human U-2 OS, 3) human HeLa, 4) rat brain, 5) rat lung, 6) mouse brain, 7) mouse lung, 8) mouse kidney, 9) mouse spleen and 10) mouse Neuro-2a lysate with PCDH15 antibody at 0.5ug/ml. Isoforms have been observed with molecular weights of: 250, 180, 160, 130, 90 and 60 kDa.
2 / 8
IHC staining of FFPE human prostate cancer with PCDH15 antibody at 1ug/ml. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min followed by cooling at RT for 20 min.
3 / 8
IHC staining of FFPE human rectal cancer with PCDH15 antibody at 1ug/ml. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min followed by cooling at RT for 20 min.
4 / 8
IHC staining of FFPE human tonsil with PCDH15 antibody at 1ug/ml. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min followed by cooling at RT for 20 min.
5 / 8
IHC staining of FFPE mouse brain with PCDH15 antibody at 1ug/ml. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min followed by cooling at RT for 20 min.
6 / 8
IHC staining of FFPE mouse spleen with PCDH15 antibody at 1ug/ml. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min followed by cooling at RT for 20 min.
7 / 8
IHC staining of FFPE rat spleen with PCDH15 antibody at 1ug/ml. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min followed by cooling at RT for 20 min.
8 / 8
Flow cytometry testing of human U-87 MG cells with PCDH15 antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= PCDH15 antibody.
❮❯

Western blot testing of 1) human placenta 2) human U-2 OS, 3) human HeLa, 4) rat brain, 5) rat lung, 6) mouse brain, 7) mouse lung, 8) mouse kidney, 9) mouse spleen and 10) mouse Neuro-2a lysate with PCDH15 antibody at 0.5ug/ml. Isoforms have been observed with molecular weights of: 250, 180, 160, 130, 90 and 60 kDa.
IHC staining of FFPE human prostate cancer with PCDH15 antibody at 1ug/ml. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min followed by cooling at RT for 20 min.
IHC staining of FFPE human rectal cancer with PCDH15 antibody at 1ug/ml. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min followed by cooling at RT for 20 min.
IHC staining of FFPE human tonsil with PCDH15 antibody at 1ug/ml. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min followed by cooling at RT for 20 min.
IHC staining of FFPE mouse brain with PCDH15 antibody at 1ug/ml. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min followed by cooling at RT for 20 min.
IHC staining of FFPE mouse spleen with PCDH15 antibody at 1ug/ml. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min followed by cooling at RT for 20 min.
IHC staining of FFPE rat spleen with PCDH15 antibody at 1ug/ml. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min followed by cooling at RT for 20 min.
Flow cytometry testing of human U-87 MG cells with PCDH15 antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= PCDH15 antibody.

No additional charges, what you see is what you pay! *

CodeSizePrice
NSJ-RQ4652-100ug100ug£535.00
Quantity:
Prices exclude any Taxes / VAT
How to order with us   Contact us
Stay in control of your spending. These prices have no additional charges, not even shipping!
* Rare exceptions are clearly labelled (only 0.14% of items!).
Multibuy discounts available! Contact us to find what you can save.
This product comes from: United States.
Typical lead time: 10-14 working days.
Contact us for more accurate information.
  • Further Information
  • Documents
  • Show All

Further Information

Application Details :
Western blot: 0.5-1ug/ml,Immunohistochemistry (FFPE): 1-2ug/ml,Flow cytometry: 1-3ug/million cells
Application Note:
Optimal dilution of the PCDH15 antibody should be determined by the researcher.
Description:
Protocadherin-15 is a protein that in humans is encoded by the PCDH15 gene. This gene is mapped to 10q21.1. This gene is a member of the cadherin superfamily. Family members encode integral membrane proteins that mediate calcium-dependent cell-cell adhesion. It plays an essential role in maintenance of normal retinal and cochlear function. Mutations in this gene result in hearing loss and Usher Syndrome Type IF (USH1F). Extensive alternative splicing resulting in multiple isoforms has been observed in the mouse ortholog. Similar alternatively spliced transcripts are inferred to occur in human, and additional variants are likely to occur.
Format :
Purified
Formulation :
0.5mg/ml if reconstituted with 0.2ml sterile DI water
Immunogen:
Amino acids DLTVYAIDPQTNRAIDRNELFKFLDGKLLDINKDFQ were used as the immunogen for the PCDH15 antibody.
Limitation:
This PCDH15 antibody is available for research use only.
Localization:
Plasma membrane, secreted
Purity:
Antigen affinity purified
Species Reactivity :
Human, Mouse, Rat
Uniprot #:
Q96QU1