NSJ Bioreagents

IDH1 Antibody / Isocitrate Dehydrogenase

Product Code:
 
NSJ-RQ6022
Product Group:
 
Primary Antibodies
Supplier:
 
NSJ Bioreagents
Host Type:
 
Mouse
Antibody Isotype:
 
Mouse IgG1
Antibody Clonality:
 
Monoclonal
Antibody Clone:
 
16H7
Regulatory Status:
 
RUO
Target Species:
  • Human
  • Mouse
  • Rat
Applications:
  • Fluorescence-activated cell sorting (FACS)
  • Immunofluorescence (IF)
  • Western Blot (WB)
Storage:
 
After reconstitution, the Isocitrate Dehydrogenase antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.
1 / 4
Immunofluorescent staining of FFPE human U-2 OS cells with Isocitrate Dehydrogenase antibody (green) and DAPI nuclear stain (blue). HIER: steam section in pH6 citrate buffer for 20 min.
2 / 4
Western blot testing of human 1) HepG2, 2) Caco-2, 3) U-87 MG, 4) ThP-1, 5) HeLa, 6) K562, 7) PC-3 and 8) HEK293 lysate with Isocitrate Dehydrogenase antibody. Predicted molecular weight ~46 kDa.
3 / 4
Western blot testing of 1) rat liver, 2) rat RH35 and 3) mouse liver lysate with Isocitrate Dehydrogenase antibody. Predicted molecular weight ~46 kDa.
4 / 4
Immunofluorescent staining of FFPE human Caco-2 cells with Isocitrate Dehydrogenase antibody (green) and DAPI nuclear stain (blue). HIER: steam section in pH6 citrate buffer for 20 min.

Immunofluorescent staining of FFPE human U-2 OS cells with Isocitrate Dehydrogenase antibody (green) and DAPI nuclear stain (blue). HIER: steam section in pH6 citrate buffer for 20 min.
Western blot testing of human 1) HepG2, 2) Caco-2, 3) U-87 MG, 4) ThP-1, 5) HeLa, 6) K562, 7) PC-3 and 8) HEK293 lysate with Isocitrate Dehydrogenase antibody. Predicted molecular weight ~46 kDa.
Western blot testing of 1) rat liver, 2) rat RH35 and 3) mouse liver lysate with Isocitrate Dehydrogenase antibody. Predicted molecular weight ~46 kDa.
Immunofluorescent staining of FFPE human Caco-2 cells with Isocitrate Dehydrogenase antibody (green) and DAPI nuclear stain (blue). HIER: steam section in pH6 citrate buffer for 20 min.

No additional charges, what you see is what you pay! *

CodeSizePrice
NSJ-RQ6022-100ug100 ug£535.00
Quantity:
Prices exclude any Taxes / VAT
Stay in control of your spending. These prices have no additional charges, not even shipping!
* Rare exceptions are clearly labelled (only 0.14% of items!).
Multibuy discounts available! Contact us to find what you can save.
This product comes from: United States.
Typical lead time: 10-14 working days.
Contact us for more accurate information.
  • Further Information
  • Documents
  • Show All

Further Information

Application Details :
Western blot: 0.5-1ug/ml,Immunofluorescence: 2-4ug/ml,Flow cytometry: 1-3ug/million cells
Application Note:
Optimal dilution of the Isocitrate Dehydrogenase antibody should be determined by the researcher.
Buffer:
Lyophilized from 1X PBS with 2% Trehalose and 0.025% sodium azide
Description:
Isocitrate dehydrogenase 1 (NADP+), soluble is an enzyme that in humans is encoded by the IDH1 gene. Isocitrate dehydrogenases catalyze the oxidative decarboxylation of isocitrate to 2-oxoglutarate. These enzymes belong to two distinct subclasses, one of which utilizes NAD(+) as the electron acceptor and the other NADP(+). Five isocitrate dehydrogenases have been reported: three NAD(+)-dependent isocitrate dehydrogenases, which localize to the mitochondrial matrix, and two NADP(+)-dependent isocitrate dehydrogenases, one of which is mitochondrial and the other predominantly cytosolic. Each NADP(+)-dependent isozyme is a homodimer. The protein encoded by this gene is the NADP(+)-dependent isocitrate dehydrogenase found in the cytoplasm and peroxisomes. It contains the PTS-1 peroxisomal targeting signal sequence. The presence of this enzyme in peroxisomes suggests roles in the regeneration of NADPH for intraperoxisomal reductions, such as the conversion of 2, 4-dienoyl-CoAs to 3-enoyl-CoAs, as well as in peroxisomal reactions that consume 2-oxoglutarate, namely the alpha-hydroxylation of phytanic acid. The cytoplasmic enzyme serves a significant role in cytoplasmic NADPH production. Alternatively spliced transcript variants encoding the same protein have been found for this gene.
Format :
Purified
Formulation :
0.5mg/ml if reconstituted with 0.2ml sterile DI water
Immunogen:
Amino acids KGLPNVQRSDYLNTFEFMDKLGENLKIKLAQAK from the human protein were used as the immunogen for the Isocitrate Dehydrogenase antibody.
Limitation:
This Isocitrate Dehydrogenase antibody is available for research use only.
Purity:
Affinity purified
Species Reactivity :
Human, Mouse, Rat
Uniprot #:
O75874