Recombinant Human IL-32 alpha protein(N-His)(active)
Application:
Cell Culture
Shipping:
This product is provided as lyophilized powder which is shipped with ice packs.
Storage:
Generally lyophilized proteins are stable for up to 12 months when stored at -20 to -80°C. Reconstituted protein solution can be stored at 4-8°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.
No additional charges, what you see is what you pay! *
Stay in control of your spending. These prices have no additional charges, not even shipping!
* Rare exceptions are clearly labelled (only 0.14% of items!).
Multibuy discounts available!
Contact us to find what you can save.
This product comes from:
China.
Typical lead time:
14-21 working days.
Contact us for more accurate information.
- Further Information
- Documents
- Show All
Further Information
IL-32 alpha
P24001-4
Measure by its ability to induce TNF alpha secretion in RAW264. 7 cells. The ED50 for this effect is < 10 ug/mL.
IL-32 is a recently discovered cytokine that induces various proinflammatory cytokines (TNF-alpha, IL-1beta, IL-6) and chemokines in both human and mouse cells through the NF-kappaB and p38 MAPK inflammatory signal pathways. It is regulated robustly by other major proinflammatory cytokines and is crucial to inflammation and immune responses. Four of the IL-32 isoforms (alpha, beta, gamma, and delta) are the most representative IL-32 transcripts, and the gamma isoform of IL-32 is the most active, although all isoforms are biologically active. IL-32, a cytokine produced mainly by T, natural killer, and epithelial cells induces significant amounts of TNFalpha and MIP-2 and increases the production of both cytokines in a dose-dependent manner. IL-32 has been implicated in inflammatory disorders, Mycobacterium tuberculosis infections, inflammatory bowel disease, and influenza A virus infection, as well as in some autoimmune diseases, such as rheumatoid arthritis, ulcerative colitis, and in the human stomach cancer, human lung cancer, and breast cancer tissues. Thus, IL-32 expression might be valuable as a biomarker for cancer.
15.73 kDa
< 0.1 EU per ug of the protein as determined by the LAL method.
E.coli
Lyophilized from sterile PBS, pH 8.0
Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween80 are added as protectants before lyophilization.
Please refer to the specific buffer information in the printed manual.
N-His
> 98 % as determined by reducing SDS-PAGE.
MCFPKVLSDDMKKLKARMHQAIERFYDKMQNAESGRGQVMSSLAELEDDFKEGYLETVAAYYEEQHPELTPLLEKERDGLRCRGNRSPVPDVEDPATEEPGESFCDKSYGAPRGDKEELTPQKCSEPQSSK
IL-32alpha;IL-32beta;IL-32delta;IL-32gamma;NK4;TAIF;TAIFa;TAIFb;TAIFc;TAIFd
P24001
