NSJ Bioreagents

Eph Receptor B1 Antibody / EphB1

Product Code:
 
NSJ-R32141
Product Group:
 
Primary Antibodies
Supplier:
 
NSJ Bioreagents
Host Type:
 
Rabbit
Antibody Isotype:
 
Rabbit IgG
Antibody Clonality:
 
Polyclonal
Regulatory Status:
 
RUO
Target Species:
 
Human
Applications:
  • Immunohistochemistry- Paraffin Embedded (IHC-P)
  • Western Blot (WB)
Storage:
 
After reconstitution, the EPHB1 antibody can be stored for up to one month at 40. For long-term, aliquot and store at -200. Avoid repeated freezing and thawing.
1 / 3
IHC testing of FFPE human glioma tissue with EPHB1 antibody. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining.
2 / 3
Western blot testing of 1) human U-251, 2) human HEL, 3) rat testis, 4) rat brain, 5) mouse testis and 6) mouse brain tissue lysate with EPHB1 antibody. Expected/observed molecular weight ~111 kDa.
3 / 3
Flow cytometry testing of human U-2 OS cells with EPHB1 antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= EPHB1 antibody.

IHC testing of FFPE human glioma tissue with EPHB1 antibody. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining.
Western blot testing of 1) human U-251, 2) human HEL, 3) rat testis, 4) rat brain, 5) mouse testis and 6) mouse brain tissue lysate with EPHB1 antibody. Expected/observed molecular weight ~111 kDa.
Flow cytometry testing of human U-2 OS cells with EPHB1 antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= EPHB1 antibody.

No additional charges, what you see is what you pay! *

CodeSizePrice
NSJ-R32141-100ug100 ug£535.00
Quantity:
Prices exclude any Taxes / VAT
Stay in control of your spending. These prices have no additional charges, not even shipping!
* Rare exceptions are clearly labelled (only 0.14% of items!).
Multibuy discounts available! Contact us to find what you can save.
This product comes from: United States.
Typical lead time: 10-14 working days.
Contact us for more accurate information.
  • Further Information
  • Documents
  • Show All

Further Information

Application Details :
Western blot: 0.1-0.5ug/ml,Immunohistochemistry (Paraffin): 0.5-1ug/ml,Flow cytometry: 1-3ug/million cells
Application Note:
Optimal dilution of the EPHB1 antibody should be determined by the researcher.
Description:
Ephrin type-B receptor 1 is a protein that in humans is encoded by the EPHB1 gene. Ephrin receptors and their ligands, the ephrins, mediate numerous developmental processes, particularly in the nervous system. Based on their structures and sequence relationships, ephrins are divided into the ephrin-A (EFNA) class, which are anchored to the membrane by a glycosylphosphatidylinositol linkage, and the ephrin-B (EFNB) class, which are transmembrane proteins. The Eph family of receptors are divided into 2 groups based on the similarity of their extracellular domain sequences and their affinities for binding ephrin-A and ephrin-B ligands. Ephrin receptors make up the largest subgroup of the receptor tyrosine kinase (RTK) family. The protein encoded by this gene is a receptor for ephrin-B family members.
Format :
Antigen affinity purified
Formulation :
0.5mg/ml if reconstituted with 0.2ml sterile DI water
Immunogen:
Amino acids RTYQVCNVFEPNQNNWLLTTFINRRGAHRIYTE of human Eph receptor B1 were used as the immunogen for the EPHB1 antibody.
Limitation:
This EPHB1antibody is available for research use only.
Localization:
Cytoplasmic, membrane
Purity:
Antigen affinity
Species Reactivity :
Human
Uniprot #:
P54762