NSJ Bioreagents

IRF2 Antibody

Product Code:
 
NSJ-R31965
Product Group:
 
Primary Antibodies
Supplier:
 
NSJ Bioreagents
Host Type:
 
Rabbit
Antibody Isotype:
 
Rabbit IgG
Antibody Clonality:
 
Polyclonal
Regulatory Status:
 
RUO
Target Species:
  • Human
  • Rat
Application:
 
Western Blot (WB)
Storage:
 
After reconstitution, the IRF2 antibody can be stored for up to one month at 40. For long-term, aliquot and store at -200. Avoid repeated freezing and thawing.
1 / 1
Western blot testing of 1) rat intestine and human 2) SW620, 3) COLO320, 4) HeLa and 5) A549 lysate with IRF2 antibody. Estimated molecular weight: ~39 kDa but routinely observed at 39-50 kDa.

Western blot testing of 1) rat intestine and human 2) SW620, 3) COLO320, 4) HeLa and 5) A549 lysate with IRF2 antibody. Estimated molecular weight: ~39 kDa but routinely observed at 39-50 kDa.

No additional charges, what you see is what you pay! *

CodeSizePrice
NSJ-R31965-100ug100 ug£535.00
Quantity:
Prices exclude any Taxes / VAT
Stay in control of your spending. These prices have no additional charges, not even shipping!
* Rare exceptions are clearly labelled (only 0.14% of items!).
Multibuy discounts available! Contact us to find what you can save.
This product comes from: United States.
Typical lead time: 10-14 working days.
Contact us for more accurate information.
  • Further Information
  • Documents
  • Show All

Further Information

Application Details :
Western blot: 0.1-0.5ug/ml
Application Note:
Optimal dilution of the IRF2 antibody should be determined by the researcher.
Description:
Specifically binds to the upstream regulatory region of type I IFN and IFN-inducible MHC class I genes (the interferon consensus sequence (ICS)) and represses those genes. Also acts as an activator for several genes including H4 and IL7. Constitutively binds to the ISRE promoter to activate IL7. Involved in cell cycle regulation through binding the site II (HiNF-M) promoter region of H4 and activating transcription during cell growth. Antagonizes IRF1 transcriptional activation. [UniProt]
Format :
Antigen affinity purified
Formulation :
0.5mg/ml if reconstituted with 0.2ml sterile DI water
Immunogen:
Amino acids MTPASSSSRPDRETRASVIKKTSDITQARVKS of human IRF2 were used as the immunogen for the IRF2 antibody.
Limitation:
This IRF2 antibody is available for research use only.
Purity:
Antigen affinity
Species Reactivity :
Human, Rat
Uniprot #:
P14316