NSJ Bioreagents

LMO2 Antibody / Rhombotin 2

Product Code:
 
NSJ-RQ4423
Product Group:
 
Primary Antibodies
Supplier:
 
NSJ Bioreagents
Host Type:
 
Rabbit
Antibody Isotype:
 
Rabbit IgG
Antibody Clonality:
 
Polyclonal
Regulatory Status:
 
RUO
Target Species:
  • Human
  • Mouse
  • Rat
Application:
 
Western Blot (WB)
Storage:
 
After reconstitution, the LMO2 antibody can be stored for up to one month at 40. For long-term, aliquot and store at -200. Avoid repeated freezing and thawing.
1 / 2
Western blot testing of human 1) placenta, 2) SMMC-7721, 3) A375 and 4 A431 lysate with LMO2 antibody at 0.5ug/ml. Predicted molecular weight ~18 kDa (isoform 1), ~25 kDa (isoform 3).
2 / 2
Western blot testing of 1) rat C6 and 2) mouse Neuro-2a lysate with LMO2 antibody at 0.5ug/ml. Predicted molecular weight ~18 kDa (isoform 1), ~25 kDa (isoform 3).
❮❯

Western blot testing of human 1) placenta, 2) SMMC-7721, 3) A375 and 4 A431 lysate with LMO2 antibody at 0.5ug/ml. Predicted molecular weight ~18 kDa (isoform 1), ~25 kDa (isoform 3).
Western blot testing of 1) rat C6 and 2) mouse Neuro-2a lysate with LMO2 antibody at 0.5ug/ml. Predicted molecular weight ~18 kDa (isoform 1), ~25 kDa (isoform 3).

No additional charges, what you see is what you pay! *

CodeSizePrice
NSJ-RQ4423-100ug100 ug£535.00
Quantity:
Prices exclude any Taxes / VAT
How to order with us   Contact us
Stay in control of your spending. These prices have no additional charges, not even shipping!
* Rare exceptions are clearly labelled (only 0.14% of items!).
Multibuy discounts available! Contact us to find what you can save.
This product comes from: United States.
Typical lead time: 10-14 working days.
Contact us for more accurate information.
  • Further Information
  • Documents
  • Show All

Further Information

Application Details :
Western blot: 0.5-1ug/ml
Application Note:
Optimal dilution of the LMO2 antibody should be determined by the researcher.
Buffer:
Lyophilized from 1X PBS with 2% Trehalose and 0.025% sodium azide
Description:
LIM domain only 2 (Rhombotin-like 1, Rhombotin 2), also known as LMO2, RBTNL1, RBTN2, RHOM2, TTG2, and T-Cell Translocation Protein 2, is a protein which in humans is encoded by the LMO2 gene. LMO2 encodes a cysteine-rich, two LIM-domain protein that is required for yolk sac erythropoiesis. The LMO2 protein has a central and crucial role in hematopoietic development and is highly conserved. The LMO2 transcription start site is located approximately 25 kb downstream from the 11p13 T-cell translocation cluster (11p13 ttc), where a number T-cell acute lymphoblastic leukemia-specific translocations occur. Alternative splicing results in multiple transcript variants encoding different isoforms.
Format :
Antigen affinity purified
Formulation :
0.5mg/ml if reconstituted with 0.2ml sterile DI water
Immunogen:
Amino acids QKHFCVGDRYLLINSDIVCEQDIYEWTKINGMI from the human protein were used as the immunogen for the LMO2 antibody.
Limitation:
This LMO2 antibody is available for research use only.
Purity:
Antigen affinity purified
Species Reactivity :
Human, Mouse, Rat
Uniprot #:
P25791