NSJ Bioreagents

MEK3 Antibody / MAP2K3 / MKK3

Product Code:
 
NSJ-R32106
Product Group:
 
Primary Antibodies
Supplier:
 
NSJ Bioreagents
Host Type:
 
Rabbit
Antibody Isotype:
 
Rabbit IgG
Antibody Clonality:
 
Polyclonal
Regulatory Status:
 
RUO
Target Species:
  • Human
  • Mouse
  • Rat
Applications:
  • Immunohistochemistry- Paraffin Embedded (IHC-P)
  • Western Blot (WB)
Storage:
 
After reconstitution, the MKK3 antibody can be stored for up to one month at 40. For long-term, aliquot and store at -200. Avoid repeated freezing and thawing.
1 / 8
Immunofluorescent staining of FFPE human Caco-2 cells with MKK3 antibody (green) and DAPI nuclear stain (blue). HIER: steam section in pH6 citrate buffer for 20 min.
2 / 8
IHC testing of FFPE human intestinal cancer tissue with MKK3 antibody. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining.
3 / 8
IHC testing of FFPE mouse skeletal muscle with MKK3 antibody. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining.
4 / 8
IHC testing of FFPE rat skeletal muscle with MKK3 antibody. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining.
5 / 8
IHC staining of FFPE human liver cancer tissue with MKK3 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
6 / 8
IHC staining of FFPE human ovarian cancer tissue with MKK3 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
7 / 8
Western blot testing of 1) human HeLa, 2) rat kidney and 3) mouse NIH 3T3 lysate with MKK3 antibody. Expected molecular weight ~39 kDa.
8 / 8
Flow cytometry testing of human Caco-2 cells with MKK3 antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= CD59 antibody.

Immunofluorescent staining of FFPE human Caco-2 cells with MKK3 antibody (green) and DAPI nuclear stain (blue). HIER: steam section in pH6 citrate buffer for 20 min.
IHC testing of FFPE human intestinal cancer tissue with MKK3 antibody. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining.
IHC testing of FFPE mouse skeletal muscle with MKK3 antibody. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining.
IHC testing of FFPE rat skeletal muscle with MKK3 antibody. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining.
IHC staining of FFPE human liver cancer tissue with MKK3 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
IHC staining of FFPE human ovarian cancer tissue with MKK3 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
Western blot testing of 1) human HeLa, 2) rat kidney and 3) mouse NIH 3T3 lysate with MKK3 antibody. Expected molecular weight ~39 kDa.
Flow cytometry testing of human Caco-2 cells with MKK3 antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= CD59 antibody.

No additional charges, what you see is what you pay! *

CodeSizePrice
NSJ-R32106-100ug100 ug£535.00
Quantity:
Prices exclude any Taxes / VAT
Stay in control of your spending. These prices have no additional charges, not even shipping!
* Rare exceptions are clearly labelled (only 0.14% of items!).
Multibuy discounts available! Contact us to find what you can save.
This product comes from: United States.
Typical lead time: 10-14 working days.
Contact us for more accurate information.
  • Further Information
  • Documents
  • Show All

Further Information

Application Details :
Western blot: 0.5-1ug/ml,Immunohistochemistry (FFPE): 2-4ug/ml,Immunofluorescence (FFPE): 5ug/ml,Flow cytometry: 1-3ug/million cells
Application Note:
Optimal dilution of the MKK3 antibody should be determined by the researcher.
Buffer:
Lyophilized from 1X PBS with 2% Trehalose and 0.025% sodium azide
Description:
Dual specificity mitogen-activated protein kinase kinase 3 is an enzyme that in humans is encoded by the MAP2K3 gene. The protein encoded by this gene is a dual specificity protein kinase that belongs to the MAP kinase kinase family. This kinase is activated by mitogenic and environmental stress, and participates in the MAP kinase-mediated signaling cascade. It phosphorylates and thus activates MAPK14/p38-MAPK. And this kinase can be activated by insulin, and is necessary for the expression of glucose transporter. Expression of RAS oncogene is found to result in the accumulation of the active form of this kinase, which thus leads to the constitutive activation of MAPK14, and confers oncogenic transformation of primary cells. Rampoldi et al. (1997) localized the MAP2K3 gene to 17q11.2.
Format :
Antigen affinity purified
Formulation :
0.5mg/ml if reconstituted with 0.2ml sterile DI water
Immunogen:
Amino acids AERMSYLELMEHPFFTLHKTKKTDIAAFVKEILGEDS of human MAP2K3/MEK3 were used as the immunogen for the MKK3 antibody.
Limitation:
This MKK3 antibody is available for research use only.
Localization:
Cytoplasmic
Purity:
Antigen affinity
Species Reactivity :
Human, Mouse, Rat
Uniprot #:
P46734