NSJ Bioreagents

P Glycoprotein Antibody

Product Code:
 
NSJ-R30136
Product Group:
 
Primary Antibodies
Supplier:
 
NSJ Bioreagents
Host Type:
 
Rabbit
Antibody Isotype:
 
Rabbit IgG
Antibody Clonality:
 
Polyclonal
Regulatory Status:
 
RUO
Target Species:
  • Human
  • Mouse
  • Rat
Applications:
  • Immunohistochemistry- Frozen Section (IHC-F)
  • Immunohistochemistry- Paraffin Embedded (IHC-P)
Storage:
 
After reconstitution, the P Glycoprotein antibody can be stored for up to one month at 40. For long-term, aliquot and store at -200. Avoid repeated freezing and thawing.
1 / 5
IHC-P: P Glycoprotein antibody testing of human lung cancer tissue
2 / 5
IHC-P: P Glycoprotein antibody testing of mouse kidney tissue
3 / 5
IHC-F testing of mouse intestine tissue
4 / 5
IHC-P: P Glycoprotein antibody testing of rat kidney tissue
5 / 5
IHC-F testing of rat kidney tissue
❮❯

IHC-P: P Glycoprotein antibody testing of human lung cancer tissue
IHC-P: P Glycoprotein antibody testing of mouse kidney tissue
IHC-F testing of mouse intestine tissue
IHC-P: P Glycoprotein antibody testing of rat kidney tissue
IHC-F testing of rat kidney tissue

No additional charges, what you see is what you pay! *

CodeSizePrice
NSJ-R30136-100ug100 ug£535.00
Quantity:
Prices exclude any Taxes / VAT
How to order with us   Contact us
Stay in control of your spending. These prices have no additional charges, not even shipping!
* Rare exceptions are clearly labelled (only 0.14% of items!).
Multibuy discounts available! Contact us to find what you can save.
This product comes from: United States.
Typical lead time: 10-14 working days.
Contact us for more accurate information.
  • Further Information
  • Documents
  • Show All

Further Information

Application Details :
Immunohistochemistry (FFPE): 0.5-1ug/ml,Immunohistochemistry (Frozen): 0.5-1ug/ml
Application Note:
The stated application concentrations are suggested starting amounts. Titration of the P Glycoprotein antibody may be required due to differences in protocols and secondary/substrate sensitivity.
Description:
P Glycoprotein, also called MDR1, P-GP, and PGY1, is a protein that in humans is encoded by the ABCB1 gene. It is mapped to 7q21.12. It is a well-characterized ABC-transporter (which transports a wide variety of substrates across extra- and intracellular membranes) of the MDR/TAP subfamily. It is an important protein of the cell membrane that pumps many foreign substances out of cells. More formally, it is an ATP-dependent drug efflux pump with broad substrate specificity. P Glycoprotein is an ATP-dependent drug efflux pump forxenobiotic compounds with broad substrate specificity. It is responsible for decreased drug accumulation in multidrug-resistant cells and often mediates the development of resistance to anticancer drugs. This protein also functions as a transporter in the blood?brain barrier.
Format :
Antigen affinity purified
Formulation :
0.5mg/ml if reconstituted with 0.2ml sterile DI water
Gene ID #:
5243
Immunogen:
Amino acids IYFKLVTMQTAGNEVELENAADESKSEIDA were used as the immunogen for this P Glycoprotein antibody.
Limitation:
This P Glycoprotein antibody is available for research use only.
Purity:
Antigen affinity
Species Reactivity :
Human, Mouse, Rat