14-3-3 zeta Antibody / YWHAZ

Contact us
NSJ Bioreagents
Product Code: NSJ-RQ4280
Product Group: Primary Antibodies
Supplier: NSJ Bioreagents
CodeSizePrice
NSJ-RQ4280-100ug100 ug£535.00
Quantity:
Prices exclude any Taxes / VAT

Overview

Host Type: Rabbit
Antibody Isotype: Rabbit IgG
Antibody Clonality: Polyclonal
Regulatory Status: RUO
Target Species:
  • Human
  • Mouse
  • Rat
Applications:
  • Immunohistochemistry- Paraffin Embedded (IHC-P)
  • Western Blot (WB)
Storage:
After reconstitution, the 14-3-3 zeta antibody can be stored for up to one month at 40. For long-term, aliquot and store at -200. Avoid repeated freezing and thawing.

Images

1 / 10
Western blot testing of human 1) HeLa, 2) placenta, 3) HepG2, 4) A549, 5) PANC-1, 6) SK-OV-3 and 7) 22RV1 lysate with 14-3-3 zeta antibody at 0.5ug/ml. Predicted molecular weight ~28 kDa.
2 / 10
Western blot testing of rat 1) brain, 2) spleen, 3) lung, 4) liver and mouse 5) brain, 6) spleen, 7) lung, 8) liver and 9) kidney lysate with 14-3-3 zeta antibody at 0.5ug/ml. Predicted molecular weight ~28 kDa.
3 / 10
IHC testing of FFPE human lung cancer tissue with 14-3-3 zeta antibody at 1ug/ml. Required HIER: steam section in pH6 citrate buffer for 20 min and allow to cool prior to staining.
4 / 10
IHC testing of FFPE human breast cancer tissue with 14-3-3 zeta antibody at 1ug/ml. Required HIER: steam section in pH6 citrate buffer for 20 min and allow to cool prior to staining.
5 / 10
IHC testing of FFPE rat kidney tissue with 14-3-3 zeta antibody at 1ug/ml. Required HIER: steam section in pH6 citrate buffer for 20 min and allow to cool prior to staining.
6 / 10
IHC testing of FFPE rat small intestine tissue with 14-3-3 zeta antibody at 1ug/ml. Required HIER: steam section in pH6 citrate buffer for 20 min and allow to cool prior to staining.
7 / 10
IF/ICC staining of FFPE human A549 cells with 14-3-3 zeta antibody (green) at 2ug/ml and DAPI nuclear stain (blue). Required HIER: steam section in pH6 citrate buffer for 20 min and allow to cool prior to staining.
8 / 10
IF/ICC staining of FFPE human A431 cells with 14-3-3 zeta antibody (green) at 2ug/ml and DAPI nuclear stain (blue). Required HIER: steam section in pH6 citrate buffer for 20 min and allow to cool prior to staining.
9 / 10
IHC testing of FFPE mouse small intestine tissue with 14-3-3 zeta antibody at 1ug/ml. Required HIER: steam section in pH6 citrate buffer for 20 min and allow to cool prior to staining.
10 / 10
Flow cytometry testing of human A431 cells with 14-3-3 zeta antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= 14-3-3 zeta antibody.
❮❯

Western blot testing of human 1) HeLa, 2) placenta, 3) HepG2, 4) A549, 5) PANC-1, 6) SK-OV-3 and 7) 22RV1 lysate with 14-3-3 zeta antibody at 0.5ug/ml. Predicted molecular weight ~28 kDa.
Western blot testing of rat 1) brain, 2) spleen, 3) lung, 4) liver and mouse 5) brain, 6) spleen, 7) lung, 8) liver and 9) kidney lysate with 14-3-3 zeta antibody at 0.5ug/ml. Predicted molecular weight ~28 kDa.
IHC testing of FFPE human lung cancer tissue with 14-3-3 zeta antibody at 1ug/ml. Required HIER: steam section in pH6 citrate buffer for 20 min and allow to cool prior to staining.
IHC testing of FFPE human breast cancer tissue with 14-3-3 zeta antibody at 1ug/ml. Required HIER: steam section in pH6 citrate buffer for 20 min and allow to cool prior to staining.
IHC testing of FFPE rat kidney tissue with 14-3-3 zeta antibody at 1ug/ml. Required HIER: steam section in pH6 citrate buffer for 20 min and allow to cool prior to staining.
IHC testing of FFPE rat small intestine tissue with 14-3-3 zeta antibody at 1ug/ml. Required HIER: steam section in pH6 citrate buffer for 20 min and allow to cool prior to staining.
IF/ICC staining of FFPE human A549 cells with 14-3-3 zeta antibody (green) at 2ug/ml and DAPI nuclear stain (blue). Required HIER: steam section in pH6 citrate buffer for 20 min and allow to cool prior to staining.
IF/ICC staining of FFPE human A431 cells with 14-3-3 zeta antibody (green) at 2ug/ml and DAPI nuclear stain (blue). Required HIER: steam section in pH6 citrate buffer for 20 min and allow to cool prior to staining.
IHC testing of FFPE mouse small intestine tissue with 14-3-3 zeta antibody at 1ug/ml. Required HIER: steam section in pH6 citrate buffer for 20 min and allow to cool prior to staining.
Flow cytometry testing of human A431 cells with 14-3-3 zeta antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= 14-3-3 zeta antibody.

Documents

Further Information

Application Details :
Western blot: 0.5-1ug/ml,Immunofluorescence/Immunocytochemistry (FFPE): 2-4ug/ml,Flow cytometry: 1-3ug/million cells,Immunohistochemistry (FFPE): 1-2ug/ml
Application Note:
Optimal dilution of the 14-3-3 zeta antibody should be determined by the researcher.
Buffer:
Lyophilized from 1X PBS with 2% Trehalose and 0.025% sodium azide
Description:
14-3-3 protein zeta/delta is a protein that in humans is encoded by the YWHAZ gene on chromosome 8. This gene product belongs to the 14-3-3 family of proteins which mediate signal transduction by binding to phosphoserine-containing proteins. This highly conserved protein family is found in both plants and mammals, and this protein is 99% identical to the mouse, rat and sheep orthologs. The encoded protein interacts with IRS1 protein, suggesting a role in regulating insulin sensitivity. Several transcript variants that differ in the 5' UTR but that encode the same protein have been identified for this gene.
Format :
Antigen affinity purified
Formulation :
0.5mg/ml if reconstituted with 0.2ml sterile DI water
Immunogen:
Amino acids LLEKFLIPNASQAESKVFYLKMKGDYYRYLAEVAAGDDKKGIVDQ were used as the immunogen for the 14-3-3 zeta antibody.
Limitation:
This 14-3-3 zeta antibody is available for research use only.
Localization:
Cytoplasm
Purity:
Antigen affinity purified
Species Reactivity :
Human, Mouse, Rat
Uniprot #:
P63104