NSJ Bioreagents

ABP1 Antibody / Amiloride binding protein 1

Product Code:
 
NSJ-R32508
Product Group:
 
Primary Antibodies
Supplier:
 
NSJ Bioreagents
Host Type:
 
Rabbit
Antibody Isotype:
 
Rabbit IgG
Antibody Clonality:
 
Polyclonal
Regulatory Status:
 
RUO
Target Species:
  • Human
  • Rat
Application:
 
Western Blot (WB)
Storage:
 
After reconstitution, the ABP1 antibody can be stored for up to one month at 40. For long-term, aliquot and store at -200. Avoid repeated freezing and thawing.
1 / 5
IHC staining of FFPE human colonic adenoma tissue with ABP1 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
2 / 5
IHC staining of FFPE human placental tissue with ABP1 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
3 / 5
IHC staining of FFPE human renal cell carcinoma tissue with ABP1 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
4 / 5
Immunofluorescent staining of FFPE human T-47D cells with ABP1 antibody (green) and DAPI nuclear stain (blue). HIER: steam section in pH6 citrate buffer for 20 min.
5 / 5
Western blot testing of 1) human 293T, 2) human HK-2 and 3) monkey COS-7 lysate with ABP1 antibody. Predicted molecular weight ~85 kDa.

IHC staining of FFPE human colonic adenoma tissue with ABP1 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
IHC staining of FFPE human placental tissue with ABP1 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
IHC staining of FFPE human renal cell carcinoma tissue with ABP1 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
Immunofluorescent staining of FFPE human T-47D cells with ABP1 antibody (green) and DAPI nuclear stain (blue). HIER: steam section in pH6 citrate buffer for 20 min.
Western blot testing of 1) human 293T, 2) human HK-2 and 3) monkey COS-7 lysate with ABP1 antibody. Predicted molecular weight ~85 kDa.

No additional charges, what you see is what you pay! *

CodeSizePrice
NSJ-R32508-100ug100 ug£535.00
Quantity:
Prices exclude any Taxes / VAT
Stay in control of your spending. These prices have no additional charges, not even shipping!
* Rare exceptions are clearly labelled (only 0.14% of items!).
Multibuy discounts available! Contact us to find what you can save.
This product comes from: United States.
Typical lead time: 10-14 working days.
Contact us for more accurate information.
  • Further Information
  • Documents
  • Show All

Further Information

Application Details :
Western blot: 0.5-1ug/ml,Immunohistochemistry (FFPE): 2-5ug/ml,Immunofluorescence (FFPE): 5ug/ml
Buffer:
Lyophilized from 1X PBS with 2% Trehalose
Description:
The AOC1 encodes a metal-binding membrane glycoprotein that oxidatively deaminates putrescine, histamine, and related compounds. The encoded protein is inhibited by amiloride, a diuretic that acts by closing epithelial sodium ion channels. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. Catalyzes the degradation of compounds such as putrescine, histamine, spermine, and spermidine, substances involved in allergic and immune responses, cell proliferation, tissue differentiation, tumor formation, and possibly apoptosis. Placental DAO is thought to play a role in the regulation of the female reproductive function.
Format :
Antigen affinity purified
Formulation :
0.5mg/ml if reconstituted with 0.2ml sterile DI water
Immunogen:
Amino acids 144-180 (STAEYALLYHTLQEATKPLHQFFLNTTGFSFQDCHDR) from the human protein were used as the immunogen for the ABP1 antibody.
Limitation:
This ABP1 antibody is available for research use only.
Localization:
Cytoplasmic, membranous
Purity:
Antigen affinity
Species Reactivity :
Human, Monkey
Uniprot #:
P19801