NSJ Bioreagents

BMP2 Antibody

Product Code:
 
NSJ-R31949
Product Group:
 
Primary Antibodies
Supplier:
 
NSJ Bioreagents
Host Type:
 
Rabbit
Antibody Isotype:
 
Rabbit IgG
Antibody Clonality:
 
Polyclonal
Regulatory Status:
 
RUO
Target Species:
  • Human
  • Rat
Applications:
  • Enzyme-Linked Immunosorbent Assay (ELISA)
  • Immunohistochemistry- Paraffin Embedded (IHC-P)
  • Western Blot (WB)
Storage:
 
After reconstitution, the BMP2 antibody can be stored for up to one month at 40. For long-term, aliquot and store at -200. Avoid repeated freezing and thawing.
1 / 2
Western blot testing of 1) rat brain, 2) rat lung, 3) human U87, 4) human HeLa lysate with BMP2 antibody. Expected/observed molecular weight ~45 kDa.~
2 / 2
IHC testing of FFPE human intestinal cancer tissue with BMP2 antibody. HIER: Boil the paraffin s
❮❯

Western blot testing of 1) rat brain, 2) rat lung, 3) human U87, 4) human HeLa lysate with BMP2 antibody. Expected/observed molecular weight ~45 kDa.~
IHC testing of FFPE human intestinal cancer tissue with BMP2 antibody. HIER: Boil the paraffin s

No additional charges, what you see is what you pay! *

CodeSizePrice
NSJ-R31949-100ug100 ug£535.00
Quantity:
Prices exclude any Taxes / VAT
How to order with us   Contact us
Stay in control of your spending. These prices have no additional charges, not even shipping!
* Rare exceptions are clearly labelled (only 0.14% of items!).
Multibuy discounts available! Contact us to find what you can save.
This product comes from: United States.
Typical lead time: 10-14 working days.
Contact us for more accurate information.
  • Further Information
  • Documents
  • Show All

Further Information

Application Details :
Western blot: 0.1-0.5ug/ml,Immunohistochemistry (FFPE): 0.5-1ug/ml,ELISA: 0.1-0.5ug/ml
Application Note:
Optimal dilution of the BMP2 antibody should be determined by the researcher.
Description:
BMP2 is also known as Bone morphogenetic protein 2 or BMP2A. It is mapped to 20p12. The protein encoded by this gene belongs to the transforming growth factor-beta (TGFB) superfamily.BMP-2, like otherbone morphogenetic proteins,plays an important role in the development of bone and cartilage. It is involved in thehedgehog pathway,TGF beta signaling pathway, and incytokine-cytokine receptor interaction. Also, it is involved in cardiac cell differentiation andepithelial to mesenchymal transition. In addition, BMP2A has been suggested as a reasonable candidate for the human condition fibrodysplasia (myositis) ossificans progressiva, on the basis of observations in a Drosophila model.
Format :
Antigen affinity purified
Formulation :
0.5mg/ml if reconstituted with 0.2ml sterile DI water
Immunogen:
Amino acids QAKHKQRKRLKSSCKRHPLYVDFSDVGWND of human BMP2 were used as the immunogen for the BMP2 antibody.
Limitation:
This BMP2 antibody is available for research use only.
Localization:
Cytoplasmic
Purity:
Antigen affinity
Species Reactivity :
Human, Rat
Uniprot #:
P12643