NSJ Bioreagents

BMP4 Antibody

Product Code:
 
NSJ-R31950
Product Group:
 
Primary Antibodies
Supplier:
 
NSJ Bioreagents
Host Type:
 
Rabbit
Antibody Isotype:
 
Rabbit IgG
Antibody Clonality:
 
Polyclonal
Regulatory Status:
 
RUO
Target Species:
  • Human
  • Mouse
Applications:
  • Enzyme-Linked Immunosorbent Assay (ELISA)
  • Western Blot (WB)
Storage:
 
After reconstitution, the BMP4 antibody can be stored for up to one month at 40. For long-term, aliquot and store at -200. Avoid repeated freezing and thawing.
1 / 1
Western blot testing of mouse 1) lung, 2) liver, 3) HEPA and human 4) HepG2, 5) HeLa lysate with BMP4 antibody. Predicted molecular weight: 54 kDa (precursor), 44 kDa (cleaved dimer), 23 kDa (cleaved monomer).

Western blot testing of mouse 1) lung, 2) liver, 3) HEPA and human 4) HepG2, 5) HeLa lysate with BMP4 antibody. Predicted molecular weight: 54 kDa (precursor), 44 kDa (cleaved dimer), 23 kDa (cleaved monomer).

No additional charges, what you see is what you pay! *

CodeSizePrice
NSJ-R31950-100ug100 ug£535.00
Quantity:
Prices exclude any Taxes / VAT
Stay in control of your spending. These prices have no additional charges, not even shipping!
* Rare exceptions are clearly labelled (only 0.14% of items!).
Multibuy discounts available! Contact us to find what you can save.
This product comes from: United States.
Typical lead time: 10-14 working days.
Contact us for more accurate information.
  • Further Information
  • Documents
  • Show All

Further Information

Application Details :
Western blot: 0.1-0.5ug/ml,ELISA : 0.1-0.5ug/ml
Application Note:
Optimal dilution of the BMP4 antibody should be determined by the researcher.
Description:
Bone morphogenetic protein 4 is a protein that in humans is encoded by the BMP4 gene. It is found on chromosome 14q22-q23. The protein encoded by this gene is a member of the bone morphogenetic protein family which is part of the transforming growth factor-beta superfamily. The superfamily includes large families of growth and differentiation factors. Bone morphogenetic proteins were originally identified by an ability of demineralized bone extract to induce endochondral osteogenesis in vivo in an extraskeletal site. This particular family member plays an important role in the onset of endochondral bone formation in humans, and a reduction in expression has been associated with a variety of bone diseases, including the heritable disorder Fibrodysplasia Ossificans Progressiva. Alternative splicing in the 5' untranslated region of this gene has been described and three variants are described, all encoding an identical protein.
Format :
Antigen affinity purified
Formulation :
0.5mg/ml if reconstituted with 0.2ml sterile DI water
Immunogen:
Amino acids SPKHHSQRARKKNKNCRRHSLYVDFSDVGWND of human BMP4 were used as the immunogen for the BMP4 antibody.
Limitation:
This BMP4 antibody is available for research use only.
Localization:
Cytoplasmic, membrane
Purity:
Antigen affinity
Species Reactivity :
Human, Mouse
Uniprot #:
P12644