NSJ Bioreagents

Connexin 46 Antibody / GJA3

Product Code:
 
NSJ-R32368
Product Group:
 
Primary Antibodies
Supplier:
 
NSJ Bioreagents
Host Type:
 
Rabbit
Antibody Isotype:
 
Rabbit IgG
Antibody Clonality:
 
Polyclonal
Regulatory Status:
 
RUO
Target Species:
  • Human
  • Mouse
  • Rat
Application:
 
Western Blot (WB)
Storage:
 
After reconstitution, the Connexin 46 antibody can be stored for up to one month at 40. For long-term, aliquot and store at -200. Avoid repeated freezing and thawing.
1 / 1
Western blot testing of 1) rat heart, 2) rat kidney, 3) human placenta, 4) mouse NIH3T3 lysate with Connexin 46 antibody. Predicted molecular weight ~46 kDa but can be observed 5-10 kDa higher (Ref 1).

Western blot testing of 1) rat heart, 2) rat kidney, 3) human placenta, 4) mouse NIH3T3 lysate with Connexin 46 antibody. Predicted molecular weight ~46 kDa but can be observed 5-10 kDa higher (Ref 1).

No additional charges, what you see is what you pay! *

CodeSizePrice
NSJ-R32368-100ug100 ug£535.00
Quantity:
Prices exclude any Taxes / VAT
Stay in control of your spending. These prices have no additional charges, not even shipping!
* Rare exceptions are clearly labelled (only 0.14% of items!).
Multibuy discounts available! Contact us to find what you can save.
This product comes from: United States.
Typical lead time: 10-14 working days.
Contact us for more accurate information.
  • Further Information
  • Documents
  • Show All

Further Information

Application Details :
Western blot: 0.1-0.5ug/ml
Application Note:
Optimal dilution of the Connexin 46 antibody should be determined by the researcher.
Description:
Gap junction alpha-3 protein, also known as Connexin-46, is a protein that in humans is encoded by the GJA3 gene. This gene is mapped to 13q12.11. The protein encoded by this gene is a connexin and is a component of lens fiber gap junctions. One gap junction consists of a cluster of closely packed pairs of transmembrane channels, the connexons, through which materials of low MW diffuse from one cell to a neighboring cell. Defects in this gene are a cause of zonular pulverulent cataract type 3 (CZP3).
Format :
Antigen affinity purified
Formulation :
0.5mg/ml if reconstituted with 0.2ml sterile DI water
Immunogen:
Amino acids TLIYLGHVLHIVRMEEKKKEREEEEQLKRE of human GJA3/Connexin 46 were used as the immunogen for the Connexin 46 antibody.
Limitation:
This Connexin 46 antibody is available for research use only.
Purity:
Antigen affinity
Species Reactivity :
Human, Mouse, Rat
Uniprot #:
Q9Y6H8