NSJ Bioreagents

FABP5 Antibody (epidermal)

Product Code:
 
NSJ-RQ4416
Product Group:
 
Primary Antibodies
Supplier:
 
NSJ Bioreagents
Host Type:
 
Rabbit
Antibody Isotype:
 
Rabbit IgG
Antibody Clonality:
 
Polyclonal
Regulatory Status:
 
RUO
Target Species:
  • Human
  • Mouse
  • Rat
Applications:
  • Immunohistochemistry- Paraffin Embedded (IHC-P)
  • Western Blot (WB)
Storage:
 
After reconstitution, the FABP5 antibody can be stored for up to one month at 40. For long-term, aliquot and store at -200. Avoid repeated freezing and thawing.
1 / 6
Immunofluorescent staining of FFPE human U-2 OS cells with FABP5 antibody (green) and DAPI nuclear stain (blue). HIER: steam section in pH6 citrate buffer for 20 min.
2 / 6
IHC testing of FFPE human esophageal squamous cell carcinoma with FABP5 antibody at 1ug/ml. Required HIER: steam section in pH6 citrate buffer for 20 min and allow to cool prior to staining.
3 / 6
IHC testing of FFPE human lung cancer tissue with FABP5 antibody at 1ug/ml. Required HIER: steam section in pH6 citrate buffer for 20 min and allow to cool prior to staining.
4 / 6
IHC testing of FFPE mouse lung tissue with FABP5 antibody at 1ug/ml. Required HIER: steam section in pH6 citrate buffer for 20 min and allow to cool prior to staining.
5 / 6
IHC testing of FFPE rat lung tissue with FABP5 antibody at 1ug/ml. Required HIER: steam section in pH6 citrate buffer for 20 min and allow to cool prior to staining.
6 / 6
Western blot testing of 1) human HeLa, 2) human A549, 3) rat thymus and 4) mouse thymus lysate with FABP5 antibody at 0.5ug/ml. Predicted molecular weight ~15 kDa.

Immunofluorescent staining of FFPE human U-2 OS cells with FABP5 antibody (green) and DAPI nuclear stain (blue). HIER: steam section in pH6 citrate buffer for 20 min.
IHC testing of FFPE human esophageal squamous cell carcinoma with FABP5 antibody at 1ug/ml. Required HIER: steam section in pH6 citrate buffer for 20 min and allow to cool prior to staining.
IHC testing of FFPE human lung cancer tissue with FABP5 antibody at 1ug/ml. Required HIER: steam section in pH6 citrate buffer for 20 min and allow to cool prior to staining.
IHC testing of FFPE mouse lung tissue with FABP5 antibody at 1ug/ml. Required HIER: steam section in pH6 citrate buffer for 20 min and allow to cool prior to staining.
IHC testing of FFPE rat lung tissue with FABP5 antibody at 1ug/ml. Required HIER: steam section in pH6 citrate buffer for 20 min and allow to cool prior to staining.
Western blot testing of 1) human HeLa, 2) human A549, 3) rat thymus and 4) mouse thymus lysate with FABP5 antibody at 0.5ug/ml. Predicted molecular weight ~15 kDa.

No additional charges, what you see is what you pay! *

CodeSizePrice
NSJ-RQ4416-100ug100 ug£535.00
Quantity:
Prices exclude any Taxes / VAT
Stay in control of your spending. These prices have no additional charges, not even shipping!
* Rare exceptions are clearly labelled (only 0.14% of items!).
Multibuy discounts available! Contact us to find what you can save.
This product comes from: United States.
Typical lead time: 10-14 working days.
Contact us for more accurate information.
  • Further Information
  • Documents
  • Show All

Further Information

Application Details :
Western blot: 0.5-1ug/ml,Immunohistochemistry (FFPE): 1-2ug/ml,Immunofluorescence: 5ug/ml
Application Note:
Optimal dilution of the FABP5 antibody should be determined by the researcher.
Buffer:
Lyophilized from 1X PBS with 2% Trehalose and 0.025% sodium azide
Description:
FABP5, Fatty acid-binding protein, epidermal, is a protein that in humans is encoded by the FABP5 gene. This gene encodes the fatty acid binding protein found in epidermal cells, and was first identified as being upregulated in psoriasis tissue. It is mapped to 8q21.13. Fatty acid binding proteins are a family of small, highly conserved, cytoplasmic proteins that bind long-chain fatty acids and other hydrophobic ligands. It is thought that FABPs roles include fatty acid uptake, transport, and metabolism.
Format :
Antigen affinity purified
Formulation :
0.5mg/ml if reconstituted with 0.2ml sterile DI water
Immunogen:
Amino acids KWRLMESHGFEEYMKELGVGLALRKMAAMAKPD from the human protein were used as the immunogen for the FABP5 antibody.
Limitation:
This FABP5 antibody is available for research use only.
Localization:
Cytoplasmic, nuclear
Purity:
Antigen affinity purified
Species Reactivity :
Human, Mouse, Rat
Uniprot #:
Q01469