NSJ Bioreagents

Frizzled 4 Antibody / FZD4

Product Code:
 
NSJ-RQ4100
Product Group:
 
Primary Antibodies
Supplier:
 
NSJ Bioreagents
Host Type:
 
Rabbit
Antibody Isotype:
 
Rabbit IgG
Antibody Clonality:
 
Polyclonal
Regulatory Status:
 
RUO
Target Species:
  • Human
  • Mouse
  • Rat
Applications:
  • Immunohistochemistry- Paraffin Embedded (IHC-P)
  • Western Blot (WB)
Storage:
 
After reconstitution, the FZD4 antibody can be stored for up to one month at 40. For long-term, aliquot and store at -200. Avoid repeated freezing and thawing.
1 / 5
Western blot testing of human 1) placenta and 2) MCF7 lysate with FZD4 antibody at 0.5ug/ml. Predicted molecular weight ~60 kDa.
2 / 5
IHC testing of FFPE human breast cancer tissue with FZD4 antibody at 1ug/ml. Required HIER: steam section in pH6 citrate buffer for 20 min and allow to cool prior to testing.
3 / 5
IHC testing of FFPE human lung cancer tissue with FZD4 antibody at 1ug/ml. Required HIER: steam section in pH6 citrate buffer for 20 min and allow to cool prior to testing.
4 / 5
IHC testing of FFPE mouse heart tissue with FZD4 antibody at 1ug/ml. Required HIER: steam section in pH6 citrate buffer for 20 min and allow to cool prior to testing.
5 / 5
IHC testing of FFPE rat heart tissue with FZD4 antibody at 1ug/ml. Required HIER: steam section in pH6 citrate buffer for 20 min and allow to cool prior to testing.

Western blot testing of human 1) placenta and 2) MCF7 lysate with FZD4 antibody at 0.5ug/ml. Predicted molecular weight ~60 kDa.
IHC testing of FFPE human breast cancer tissue with FZD4 antibody at 1ug/ml. Required HIER: steam section in pH6 citrate buffer for 20 min and allow to cool prior to testing.
IHC testing of FFPE human lung cancer tissue with FZD4 antibody at 1ug/ml. Required HIER: steam section in pH6 citrate buffer for 20 min and allow to cool prior to testing.
IHC testing of FFPE mouse heart tissue with FZD4 antibody at 1ug/ml. Required HIER: steam section in pH6 citrate buffer for 20 min and allow to cool prior to testing.
IHC testing of FFPE rat heart tissue with FZD4 antibody at 1ug/ml. Required HIER: steam section in pH6 citrate buffer for 20 min and allow to cool prior to testing.

No additional charges, what you see is what you pay! *

CodeSizePrice
NSJ-RQ4100-100ug100 ug£535.00
Quantity:
Prices exclude any Taxes / VAT
Stay in control of your spending. These prices have no additional charges, not even shipping!
* Rare exceptions are clearly labelled (only 0.14% of items!).
Multibuy discounts available! Contact us to find what you can save.
This product comes from: United States.
Typical lead time: 10-14 working days.
Contact us for more accurate information.
  • Further Information
  • Documents
  • Show All

Further Information

Application Details :
Western Blot: 0.5-1ug/ml,Immunohistochemistry (FFPE): 1-2ug/ml
Application Note:
Optimal dilution of the FZD4 antibody should be determined by the researcher.
Buffer:
Lyophilized from 1X PBS with 2% Trehalose and 0.025% sodium azide
Description:
Frizzled-4 is a protein that in humans is encoded by the FZD4 gene. This gene is a member of the frizzled gene family. Members of this family encode seven-transmembrane domain proteins that are receptors for the Wingless type MMTV integration site family of signaling proteins. Most frizzled receptors are coupled to the beta-catenin canonical signaling pathway. This protein may play a role as a positive regulator of the Wingless type MMTV integration site signaling pathway. A transcript variant retaining intronic sequence and encoding a shorter isoform has been described, however, its expression is not supported by other experimental evidence.
Format :
Antigen affinity purified
Formulation :
0.5mg/ml if reconstituted with 0.2ml sterile DI water
Immunogen:
Amino acids QNLGYNVTKMPNLVGHELQTDAELQLTTFTPLIQY from the human protein were used as the immunogen for the FZD4 antibody.
Limitation:
This FZD4 antibody is available for research use only.
Localization:
Cytoplasmic, membrane
Purity:
Antigen affinity purified
Species Reactivity :
Human, Mouse, Rat
Uniprot #:
Q9ULV1