NSJ Bioreagents

HSPA2 Antibody

Product Code:
 
NSJ-R32139
Product Group:
 
Primary Antibodies
Supplier:
 
NSJ Bioreagents
Host Type:
 
Rabbit
Antibody Isotype:
 
Rabbit IgG
Antibody Clonality:
 
Polyclonal
Regulatory Status:
 
RUO
Target Species:
  • Human
  • Mouse
  • Rat
Applications:
  • Immunohistochemistry- Paraffin Embedded (IHC-P)
  • Western Blot (WB)
Storage:
 
After reconstitution, the HSPA2 antibody can be stored for up to one month at 40. For long-term, aliquot and store at -200. Avoid repeated freezing and thawing.
1 / 7
Western blot testing of 1) rat liver, 2) rat thymus, 3) rat testis, 4) mouse liver, 5) mouse kidney, 6) human HeLa, 7) human MCF7 and 8) human A375 and 9) mouse NIH3T3 lysate with HSPA2 antibody. Expected/observed molecular weight ~70 kDa.
2 / 7
IHC testing of FFPE human lung cancer tissue with HSPA2 antibody. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining.
3 / 7
IHC testing of FFPE mouse intestine with HSPA2 antibody. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining.
4 / 7
IHC testing of FFPE rat intestine with HSPA2 antibody. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining.
5 / 7
IF/ICC staining of FFPE human PC-3 cells with HSPA2 antibody (green) at 2ug/ml and DAPI nuclear stain (blue). HIER: steam section in pH6 citrate buffer for 20 min.
6 / 7
IF/ICC staining of FFPE human PC-3 cells with HSPA2 antibody at 2ug/ml. HIER: steam section in pH6 citrate buffer for 20 min.
7 / 7
Flow cytometry testing of human PC-3 cells with HSPA2 antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= HSPA2 antibody.

Western blot testing of 1) rat liver, 2) rat thymus, 3) rat testis, 4) mouse liver, 5) mouse kidney, 6) human HeLa, 7) human MCF7 and 8) human A375 and 9) mouse NIH3T3 lysate with HSPA2 antibody. Expected/observed molecular weight ~70 kDa.
IHC testing of FFPE human lung cancer tissue with HSPA2 antibody. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining.
IHC testing of FFPE mouse intestine with HSPA2 antibody. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining.
IHC testing of FFPE rat intestine with HSPA2 antibody. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining.
IF/ICC staining of FFPE human PC-3 cells with HSPA2 antibody (green) at 2ug/ml and DAPI nuclear stain (blue). HIER: steam section in pH6 citrate buffer for 20 min.
IF/ICC staining of FFPE human PC-3 cells with HSPA2 antibody at 2ug/ml. HIER: steam section in pH6 citrate buffer for 20 min.
Flow cytometry testing of human PC-3 cells with HSPA2 antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= HSPA2 antibody.

No additional charges, what you see is what you pay! *

CodeSizePrice
NSJ-R32139-100ug100 ug£535.00
Quantity:
Prices exclude any Taxes / VAT
Stay in control of your spending. These prices have no additional charges, not even shipping!
* Rare exceptions are clearly labelled (only 0.14% of items!).
Multibuy discounts available! Contact us to find what you can save.
This product comes from: United States.
Typical lead time: 10-14 working days.
Contact us for more accurate information.
  • Further Information
  • Documents
  • Show All

Further Information

Application Details :
Western blot: 0.1-0.5ug/ml,Immunohistochemistry (FFPE): 0.5-1ug/ml,Immunofluorescence/Immunocytochemistry: 2-4ug/ml,Flow cytometry: 1-3ug/million cells
Application Note:
Optimal dilution of the HSPA2 antibody should be determined by the researcher.
Description:
HSPA2 (heat shock 70kDa protein 2) is also known as HEAT-SHOCK PROTEIN, 70-KD, 2, HSP70-2, HEAT-SHOCK PROTEIN, 70-KD, 3 or HSP70-3. Analysis of the sequence indicated that HSPA2 is the human homolog of the murine Hsp70-2 gene, with 91.7% identity in the nucleotide coding sequence and 98.2% in the corresponding amino acid sequence. HSPA2 has less amino acid homology to the other members of the human HSP70 gene family. HSPA2 is constitutively expressed in most tissues, with very high levels in testis and skeletal muscle. The HSPA2 gene is located on chromosome 14q22-q24. Immunohistochemical analysis detected weak expression of HSPA2 in spermatocytes and stronger expression in spermatids and in the tail of mature sperm. HSPA2 may be critical to sperm maturation through its role as a protein chaperone.
Format :
Antigen affinity purified
Formulation :
0.5mg/ml if reconstituted with 0.2ml sterile DI water
Immunogen:
Amino acids KISEQDKNKILDKCQEVINWLDRNQMAEKDEYEHK of human HSPA2 were used as the immunogen for the HSPA2 antibody.
Limitation:
This HSPA2 antibody is available for research use only.
Localization:
Nuclear, cytoplasmic
Purity:
Antigen affinity
Species Reactivity :
Human, Mouse, Rat
Uniprot #:
P54652