NSJ Bioreagents

MSI1 Antibody / Musashi 1

Product Code:
 
NSJ-R32645
Product Group:
 
Primary Antibodies
Supplier:
 
NSJ Bioreagents
Host Type:
 
Rabbit
Antibody Isotype:
 
Rabbit IgG
Antibody Clonality:
 
Polyclonal
Regulatory Status:
 
RUO
Target Species:
  • Human
  • Mouse
  • Rat
Applications:
  • Immunohistochemistry- Paraffin Embedded (IHC-P)
  • Western Blot (WB)
Storage:
 
After reconstitution, the Musashi antibody can be stored for up to one month at 40. For long-term, aliquot and store at -200. Avoid repeated freezing and thawing.
1 / 9
IHC testing of FFPE human breast cancer tissue with Musashi antibody at 1ug/ml. Required HIER: steam section in pH6 citrate buffer for 20 min and allow to cool prior to testing.
2 / 9
IHC testing of FFPE human lung cancer tissue with Musashi antibody at 1ug/ml. Required HIER: steam section in pH6 citrate buffer for 20 min and allow to cool prior to testing.
3 / 9
IHC testing of FFPE mouse intestine tissue with Musashi antibody at 1ug/ml. Required HIER: steam section in pH6 citrate buffer for 20 min and allow to cool prior to testing.
4 / 9
IHC testing of FFPE rat intestine tissue with Musashi antibody at 1ug/ml. Required HIER: steam section in pH6 citrate buffer for 20 min and allow to cool prior to testing.
5 / 9
IHC testing of FFPE rat brain tissue with Musashi antibody at 1ug/ml. Required HIER: steam section in pH6 citrate buffer for 20 min and allow to cool prior to testing.
6 / 9
Western blot testing of 1) rat brain, 2) rat testis, 3) mouse brain, 4) human 293T, 5) human 293T and 6) human HepG2 lysate at 0.5ug/ml. Predicted molecular weight ~39 kDa.
7 / 9
Western blot testing of 1) human 293T, 2) human T-47D, 3) human COLO-320, 4) rat brain and 5) mouse brain lysate with Musashi antibody at 0.5ug/ml. Predicted molecular weight ~39 kDa.
8 / 9
Immunofluorescent staining of FFPE human MCF7 cells with Musashi antibody (green) and DAPI nuclear stain (blue). HIER: steam section in pH6 citrate buffer for 20 min.
9 / 9
Flow cytometry testing of human Caco-2 cells with Musashi antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= Musashi antibody.

IHC testing of FFPE human breast cancer tissue with Musashi antibody at 1ug/ml. Required HIER: steam section in pH6 citrate buffer for 20 min and allow to cool prior to testing.
IHC testing of FFPE human lung cancer tissue with Musashi antibody at 1ug/ml. Required HIER: steam section in pH6 citrate buffer for 20 min and allow to cool prior to testing.
IHC testing of FFPE mouse intestine tissue with Musashi antibody at 1ug/ml. Required HIER: steam section in pH6 citrate buffer for 20 min and allow to cool prior to testing.
IHC testing of FFPE rat intestine tissue with Musashi antibody at 1ug/ml. Required HIER: steam section in pH6 citrate buffer for 20 min and allow to cool prior to testing.
IHC testing of FFPE rat brain tissue with Musashi antibody at 1ug/ml. Required HIER: steam section in pH6 citrate buffer for 20 min and allow to cool prior to testing.
Western blot testing of 1) rat brain, 2) rat testis, 3) mouse brain, 4) human 293T, 5) human 293T and 6) human HepG2 lysate at 0.5ug/ml. Predicted molecular weight ~39 kDa.
Western blot testing of 1) human 293T, 2) human T-47D, 3) human COLO-320, 4) rat brain and 5) mouse brain lysate with Musashi antibody at 0.5ug/ml. Predicted molecular weight ~39 kDa.
Immunofluorescent staining of FFPE human MCF7 cells with Musashi antibody (green) and DAPI nuclear stain (blue). HIER: steam section in pH6 citrate buffer for 20 min.
Flow cytometry testing of human Caco-2 cells with Musashi antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= Musashi antibody.

No additional charges, what you see is what you pay! *

CodeSizePrice
NSJ-R32645-100ug100ug£535.00
Quantity:
Prices exclude any Taxes / VAT
Stay in control of your spending. These prices have no additional charges, not even shipping!
* Rare exceptions are clearly labelled (only 0.14% of items!).
Multibuy discounts available! Contact us to find what you can save.
This product comes from: United States.
Typical lead time: 10-14 working days.
Contact us for more accurate information.
  • Further Information
  • Documents
  • Show All

Further Information

Application Details :
Western blot: 0.5-1ug/ml,Immunohistochemistry (FFPE): 1-2ug/ml
Application Note:
Optimal dilution of the Musashi antibody should be determined by the researcher.
Buffer:
Lyophilized from 1X PBS with 2.5% BSA, 0.025% sodium azide
Description:
RNA-binding protein Musashi homolog 1 is a protein that in humans is encoded by the MSI1 gene. This gene encodes a protein containing two conserved tandem RNA recognition motifs. Similar proteins in other species function as RNA-binding proteins and play central roles in posttranscriptional gene regulation. Expression of this gene has been correlated with the grade of the malignancy and proliferative activity in gliomas and melanomas. A pseudogene for this gene is located on chromosome 11q13.
Format :
Antigen affinity purified
Formulation :
0.5mg/ml if reconstituted with 0.2ml sterile DI water
Immunogen:
Amino acids 21-54 (KMFIGGLSWQTTQEGLREYFGQFGEVKECLVMRD) from the human protein were used as the immunogen for the Musashi antibody.
Limitation:
This Musashi antibody is available for research use only.
Purity:
Antigen affinity
Species Reactivity :
Human, Mouse, Rat
Uniprot #:
O43347