NSJ Bioreagents

SKP2 Antibody

Product Code:
 
NSJ-RQ4170
Product Group:
 
Primary Antibodies
Supplier:
 
NSJ Bioreagents
Host Type:
 
Rabbit
Antibody Isotype:
 
Rabbit IgG
Antibody Clonality:
 
Polyclonal
Regulatory Status:
 
RUO
Target Species:
 
Human
Application:
 
Western Blot (WB)
Storage:
 
After reconstitution, the SKP2 antibody can be stored for up to one month at 40. For long-term, aliquot and store at -200. Avoid repeated freezing and thawing.
1 / 1
Western blot testing of human 1) SGC-7901 and 2) SK-OV-3 cell lysate with SKP2 antibody at 0.5ug/ml. Predicted molecular weight ~48 kDa.
❮❯

Western blot testing of human 1) SGC-7901 and 2) SK-OV-3 cell lysate with SKP2 antibody at 0.5ug/ml. Predicted molecular weight ~48 kDa.

No additional charges, what you see is what you pay! *

CodeSizePrice
NSJ-RQ4170-100ug100 ug£535.00
Quantity:
Prices exclude any Taxes / VAT
How to order with us   Contact us
Stay in control of your spending. These prices have no additional charges, not even shipping!
* Rare exceptions are clearly labelled (only 0.14% of items!).
Multibuy discounts available! Contact us to find what you can save.
This product comes from: United States.
Typical lead time: 10-14 working days.
Contact us for more accurate information.
  • Further Information
  • Documents
  • Show All

Further Information

Application Details :
Western Blot: 0.5-1ug/ml
Application Note:
Optimal dilution of the SKP2 antibody should be determined by the researcher.
Buffer:
Lyophilized from 1X PBS with 2% Trehalose and 0.025% sodium azide
Description:
The F box protein Skp2 (S-phase kinase-associated protein 2) is oncogenic, and its frequent amplification and overexpression correlate with the grade of malignancy of certain tumors. Skp2 controls p300-p53 signaling pathways in cancer cells, making it a potential molecular target for cancer therapy. This gene positively regulates the G(1)-S transition by controlling the stability of several G(1) regulators, such as the cell cycle inhibitor p27. This study provides evidence of a role for an F-box protein in oncogenesis and establishes SKP2 as a protooncogene causally involved in the pathogenesis of lymphomas.
Format :
Antigen affinity purified
Formulation :
0.5mg/ml if reconstituted with 0.2ml sterile DI water
Immunogen:
Amino acids ETLLELGEIPTLKTLQVFGIVPDGTLQLLKEALPHL were used as the immunogen for the SKP2 antibody.
Limitation:
This SKP2 antibody is available for research use only.
Purity:
Antigen affinity purified
Species Reactivity :
Human
Uniprot #:
Q13309