Abnova Corporation

Chitin-bindingdomain Protein

Product Code:
P6691
Product Group:
Other Proteins
Host Type:
Wheat Germ (in vitro)
Regulatory Status:
RUO
Applications:
  • Antibody Production
  • Array
  • Enzyme-Linked Immunosorbent Assay (ELISA)
  • Western Blot (WB)
Storage:
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
 

No additional charges, what you see is what you pay! *

Stay in control of your spending. These prices have no additional charges to UK mainland customers, not even shipping!
* Rare exceptions are clearly labelled (only 0.14% of items!).
Multibuy discounts available! Contact us to find what you can save.
This product comes from: Taiwan.
Typical lead time: 14-21 working days.
Contact us for more accurate information.
  • Further Information
  • Documents
  • Show All

Further Information

Genbank Accession:
no gene_acc
Immunogen Sequence Protein Sequence:
TNPGVSAWQVNTAYTAGQLVTYNGKTYKCLQPHTSLAGWEPSNVPALWQLQ
Note:
Best use within three months from the date of receipt of this protein.
Preparation Method:
Product Description:
Chitin-binding domain partial recombinant protein.
Protein Accession:
no protein_acc
Quality Control Testing:
12.5% SDS-PAGE Stained with Coomassie Blue
Storage Buffer:
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Tag:
GST